PDE4C Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PDE4C Polyclonal antibody, PBS Only (21754-1-PBS)

• 

  WB analysis of HEK-293 using 21754-1-AP (same clone as 21754-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21754-1-AP (PDE4C antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21754-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 21754-1-AP (same clone as 21754-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 21754-1-AP (PDE4C antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21754-1-PBS in a different storage buffer formulation.

PDE4C Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21754-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21754-1-PBS targets PDE4C in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16130

  Product name: Recombinant human PDE4C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-91 aa of BC109067

  Sequence: EYISRTFLDQQTEVELPKVTAEEAPQPMSRISGLHGLCHSASLSSATVPRFGVQTDQEEQLAK

• Full Name: phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila)
• Calculated Molecular Weight: 712 aa, 80 kDa
• Observed Molecular Weight: ~70 kDa
• GenBank Accession Number: BC109067
• Gene Symbol: PDE4C
• Gene ID (NCBI): 5143
• RRID: AB_10860265
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q08493
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PDE4C(cAMP-specific 3,5-cyclic phosphodiesterase 4C) is also named as DPDE1 and belongs to the PDE4 subfamily, which play a key role in lung inflammation and hyperresponsiveness. PDE4C promotes the hydrolysis of cAMP, and PKD2, functioning as a Ca2+ entry channel, may mediate local accumulation of Ca2+ that inhibits the activity of Ca2+-sensitive ADCY5(PMID:21670265). The three isoforms(84,75, and 64 kDa) of PDE4C have been detected in cytosolic, microsomal, and nuclear (PMID:21784969).