PDE5A Recombinant monoclonal antibody, PBS Only (Detector)

PDE5A Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA
Cat No. 85030-1-PBS
Clone No.242597B10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA

242597B10, CGB-PDE, cGMP-binding cGMP-specific phosphodiesterase, cGMP-specific 3',5'-cyclic phosphodiesterase, CN5A

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85030-1-PBS targets PDE5A as part of a matched antibody pair:

MP01762-3: 85030-4-PBS capture and 85030-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18779

Product name: Recombinant human PDE5A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 321-482 aa of BC126233

Sequence: ETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYAQYVKNTMEPLNIPDVSKDKRFPWTTENTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGKVK

Predict reactive species
Full Name phosphodiesterase 5A, cGMP-specific
Calculated Molecular Weight 875 aa, 100 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC126233
Gene Symbol PDE5A
Gene ID (NCBI) 8654
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO76074
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PDE5A (cGMP-binding cGMP-specific phosphodiesterase) plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase catalyzes the specific hydrolysis of cGMP to 5'-GMP. Through alternative splicing, the PDE5A gene produces three proteins (PDE5A1, PDE5A2, and PDE5A3) that differ in their N termini and range in mass from 89 to 105 kDa. (PMID: 25704994; 21215707). A second 70 kDa band was consistently observed in heart tissue that either reflected a splice variant or proteolytic fragment of PDE5A. (PMID: 15576651).

Loading...
||
New chat

Able

正在加载,请稍候...