• All
  • Primary Antibodies
  • Conjugated Antibodies for IF
  • Conjugated Antibodies for FC
  • Secondary Antibodies
  • Antibody Labeling KitsNew
  • ELISA Kits
  • IHC Kits
  • Magnetic Cell Separation Kits
  • Cytokines & Growth Factors
  • Neutralizing/activating Antibodies
  • Nanobody-based Reagents
  • Accessory Products and Kits
  • Fusion Proteins
×
×
Host
0
Species Reactivity
0
Species Reactivity
0
Conjugate
0
Conjugate
0
Compatible Species
0
Conjugate
0
Filter:
  • Western Blot (WB) analysis of mouse lung tissue using PDE5A Recombinant antibody (85030-1-RR)

    WB analysis of mouse lung using 85030-1-RR

    mouse lung tissue were subjected to SDS PAGE followed by western blot with 85030-1-RR (PDE5A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of rat lung tissue using PDE5A Recombinant antibody (85030-1-RR)

    WB analysis of rat lung using 85030-1-RR

    rat lung tissue were subjected to SDS PAGE followed by western blot with 85030-1-RR (PDE5A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  • Immunohistochemistry (IHC) staining of human ovary cancer tissue using PDE5A Recombinant antibody (85030-1-RR)

    IHC staining of human ovary cancer using 85030-1-RR

    Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 85030-1-RR (PDE5A antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunofluorescence (IF) / fluorescent staining of SKOV-3 cells using PDE5A Recombinant antibody (85030-1-RR)

    IF Staining of SKOV-3 using 85030-1-RR

    Immunofluorescent analysis of (4% PFA) fixed SKOV-3 cells using PDE5A antibody (85030-1-RR, Clone: 242597B10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  • Flow cytometry (FC) experiment of HEK-293 cells using PDE5A Recombinant antibody (85030-1-RR)

    FC experiment of HEK-293 using 85030-1-RR

    1x10^6 HEK-293 cells were intracellularly stained with 0.25 ug PDE5A Recombinant antibody (85030-1-RR, Clone:242597B10) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

  • Affinity and Kinetic Characterization of 85030-1-RR

    Affinity and Kinetic Characterization of 85030-1-RR

    Biolayer interferometry (BLl) kinetic assays of 85030-1-RR against Human PDE5A were performed. The affinity constant is 1.07 nM.

PDE5A Recombinant monoclonal antibody

PDE5A Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 85030-1-RR
Clone No.242597B10

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

242597B10, CGB-PDE, cGMP-binding cGMP-specific phosphodiesterase, cGMP-specific 3',5'-cyclic phosphodiesterase, CN5A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Tested Applications

Positive WB detected inmouse lung tissue, rat lung tissue
Positive IHC detected inhuman ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inSKOV-3 cells
Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:300-1:1200
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85030-1-RR targets PDE5A in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18779

Product name: Recombinant human PDE5A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 321-482 aa of BC126233

Sequence: ETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYAQYVKNTMEPLNIPDVSKDKRFPWTTENTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGKVK

Predict reactive species
Full Name phosphodiesterase 5A, cGMP-specific
Calculated Molecular Weight 875 aa, 100 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC126233
Gene Symbol PDE5A
Gene ID (NCBI) 8654
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO76074
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDE5A (cGMP-binding cGMP-specific phosphodiesterase) plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase catalyzes the specific hydrolysis of cGMP to 5'-GMP. Through alternative splicing, the PDE5A gene produces three proteins (PDE5A1, PDE5A2, and PDE5A3) that differ in their N termini and range in mass from 89 to 105 kDa. (PMID: 25704994; 21215707). A second 70 kDa band was consistently observed in heart tissue that either reflected a splice variant or proteolytic fragment of PDE5A. (PMID: 15576651).

Protocols

Product Specific Protocols
FC protocol for PDE5A antibody 85030-1-RRDownload protocol
IF protocol for PDE5A antibody 85030-1-RRDownload protocol
IHC protocol for PDE5A antibody 85030-1-RRDownload protocol
WB protocol for PDE5A antibody 85030-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
||
New chat Able
正在加载，请稍候...