CoraLite® Plus 488-conjugated PDE5A Recombinant monoclonal antibody

• 

  IF Staining of SKOV-3 using CL488-85030

  Immunofluorescent analysis of (4% PFA) fixed SKOV-3 cells using CoraLite® Plus 488 PDE5A antibody (CL488-85030, Clone: 242597B10 ) at dilution of 1:200.

PDE5A Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-85030

Clone No.242597B10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

242597B10, CGB-PDE, cGMP-binding cGMP-specific phosphodiesterase, cGMP-specific 3',5'-cyclic phosphodiesterase, CN5A

---

Tested Applications

• Positive IF/ICC detected in: SKOV-3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85030 targets PDE5A in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18779

  Product name: Recombinant human PDE5A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 321-482 aa of BC126233

  Sequence: ETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYAQYVKNTMEPLNIPDVSKDKRFPWTTENTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGKVK

• Full Name: phosphodiesterase 5A, cGMP-specific
• Calculated Molecular Weight: 875 aa, 100 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC126233
• Gene Symbol: PDE5A
• Gene ID (NCBI): 8654
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O76074
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

PDE5A (cGMP-binding cGMP-specific phosphodiesterase) plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase catalyzes the specific hydrolysis of cGMP to 5'-GMP. Through alternative splicing, the PDE5A gene produces three proteins (PDE5A1, PDE5A2, and PDE5A3) that differ in their N termini and range in mass from 89 to 105 kDa. (PMID: 25704994; 21215707). A second 70 kDa band was consistently observed in heart tissue that either reflected a splice variant or proteolytic fragment of PDE5A. (PMID: 15576651).