Tested Applications
| Positive WB detected in | mouse eye tissue, rat eye tissue, mouse retina tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67832-1-Ig targets PDE6A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16741 Product name: Recombinant human PDE6A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-90 aa of BC035909 Sequence: MGEVTAEEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQENLQTEKCIFNVMKKLCFLLQ Predict reactive species |
| Full Name | phosphodiesterase 6A, cGMP-specific, rod, alpha |
| Calculated Molecular Weight | 860 aa, 100 kDa |
| Observed Molecular Weight | 100 kDa |
| GenBank Accession Number | BC035909 |
| Gene Symbol | PDE6A |
| Gene ID (NCBI) | 5145 |
| RRID | AB_2918594 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P16499 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PDE6A(Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha) is also named as GMP-PDE alpha, PDE V-B1, PDEA and belongs to the cyclic nucleotide phosphodiesterase family. PDE6A contains an open reading frame capable of coding for a polypeptide of 859 amino acids and about 100 kDa. It is a subunit of a key phototransduction enzyme which participates in processes of transmission and amplification of the visual signal. The expression of PDE6 alpha in retina is essential for normal expression of PDE6 beta and PDE6 gama.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PDE6A antibody 67832-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





