Filter: AllWBAffinity

WB analysis of rat lung using 87506-1-RR (same clone as 87506-1-PBS)
rat lung tissue were subjected to SDS PAGE followed by western blot with 87506-1-RR (PDGF-BB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87506-1-PBS in a different storage buffer formulation.
WB analysis of SH-SY5Y using 87506-1-RR (same clone as 87506-1-PBS)
SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 87506-1-RR (PDGF-BB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87506-1-PBS in a different storage buffer formulation.
WB analysis using 87506-1-RR (same clone as 87506-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 87506-1-RR (PDGF-BB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87506-1-PBS in a different storage buffer formulation.
Affinity of 87506-1-RR
Biolayer interferometry (BLl) kinetic assays of 87506-1-RR against Mouse PDGF-BB were performed. The affinity constant is 2.21 nM.

Mouse PDGF-BB Recombinant monoclonal antibody, PBS Only

Name: Mouse PDGF-BB Recombinant monoclonal antibody, PBS Only
Brand: Proteintech
SKU: 87506-1-PBS

PDGF-BB Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87506-1-PBS

Clone No.252712C5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

PDGF subunit B, PDGF-2, Pdgfb, Platelet-derived growth factor B chain, Platelet-derived growth factor beta polypeptide

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

87506-1-PBS targets PDGF-BB in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg4856 Product name: recombinant mouse PDGF-BB protein Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 82-190 aa of AAH23427.1 Sequence: SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT Predict reactive species
Full Name	platelet derived growth factor, B polypeptide
Calculated Molecular Weight	25kd
Observed Molecular Weight	30 kDa
GenBank Accession Number	AAH23427.1
Gene Symbol	Pdgfb
Gene ID (NCBI)	18591
RRID	AB_3745588
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P31240
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.