Mouse PDGF-BB Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Mouse PDGF-BB Recombinant monoclonal antibody, PBS Only (87506-1-PBS)

PDGF-BB Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87506-1-PBS

Clone No.252712C5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

PDGF subunit B, PDGF-2, Pdgfb, Platelet-derived growth factor B chain, Platelet-derived growth factor beta polypeptide

• 

  WB analysis of rat lung using 87506-1-RR (same clone as 87506-1-PBS)

  rat lung tissue were subjected to SDS PAGE followed by western blot with 87506-1-RR (PDGF-BB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87506-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 87506-1-RR (same clone as 87506-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 87506-1-RR (PDGF-BB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87506-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87506-1-RR (same clone as 87506-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87506-1-RR (PDGF-BB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87506-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87506-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87506-1-RR against Mouse PDGF-BB were performed. The affinity constant is 2.21 nM.

---

Product Information

87506-1-PBS targets PDGF-BB in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4856

  Product name: recombinant mouse PDGF-BB protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 82-190 aa of AAH23427.1

  Sequence: SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT

• Full Name: platelet derived growth factor, B polypeptide
• Calculated Molecular Weight: 25kd
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: AAH23427.1
• Gene Symbol: Pdgfb
• Gene ID (NCBI): 18591
• RRID: AB_3745588
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P31240
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Platelet-derived growth factor (PDGF) belongs to the family of growth factors consisting of four secreted extracellular ligands including PDGF-A, -B, -C and -D. These isoforms, PDGF-AA, PDGF-AB, PDGF-BB, PDGF-CC and PDGF-DD, act via two receptor tyrosine kinases, PDGF receptors alpha and beta. PDGF isoforms stimulate growth, survival and motility of mesenchymal cells and certain other cell type. They have important functions during embryonal development and in the control of tissue homeostasis in the adult. PDGF-BB is one of the most recently studied isoforms and it plays an important role in skeletal development. PDGF-BB stimulates cell-mediated collagen gel contraction. PDGF-BB modulates endothelial proliferation and angiogenesis in vitro via PDGF beta-receptors.