PDGF-BB Recombinant monoclonal antibody

• 

  WB analysis of rat lung using 87506-1-RR

  rat lung tissue were subjected to SDS PAGE followed by western blot with 87506-1-RR (PDGF-BB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 87506-1-RR

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 87506-1-RR (PDGF-BB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87506-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87506-1-RR (PDGF-BB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87506-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87506-1-RR against Mouse PDGF-BB were performed. The affinity constant is 2.21 nM.

PDGF-BB Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87506-1-RR

Clone No.252712C5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

PDGF subunit B, PDGF-2, Pdgfb, Platelet-derived growth factor B chain, Platelet-derived growth factor beta polypeptide

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat lung tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87506-1-RR targets PDGF-BB in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4856

  Product name: recombinant mouse PDGF-BB protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 82-190 aa of AAH23427.1

  Sequence: SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT

• Full Name: platelet derived growth factor, B polypeptide
• Calculated Molecular Weight: 25kd
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: AAH23427.1
• Gene Symbol: Pdgfb
• Gene ID (NCBI): 18591
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P31240
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.