PDGFR beta/CD140b Recombinant monoclonal antibody

• 

  WB analysis using 84388-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84388-5-RR (PDGF R beta antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of NIH/3T3 using 84388-5-RR

  Immunofluorescent analysis of (-20°C Methanol) fixed NIH/3T3 cells using PDGFR beta/CD140b antibody (84388-5-RR, Clone: 241754A6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 84388-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84388-5-RR against Mouse PDGF R beta were performed. The affinity constant is below 1 pM.

PDGFR beta/CD140b Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 84388-5-RR

Clone No.241754A6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IF/ICC, ELISA

Synonyms

241754A6, Beta platelet-derived growth factor receptor, Beta-type platelet-derived growth factor receptor, CD140 antigen-like family member B, CD140b

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, C2C12 cells
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84388-5-RR targets PDGFR beta/CD140b in WB, IF/ICC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1533

  Product name: Recombinant Mouse PDGFR beta protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 32-531 aa of NM_008809.2

  Sequence: LVITPPGPEFVLNISSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFKV

• Full Name: platelet derived growth factor receptor, beta polypeptide
• Calculated Molecular Weight: 123kDa
• Observed Molecular Weight: 180 kDa
• GenBank Accession Number: NM_008809.2
• Gene Symbol: PDGFR beta
• Gene ID (NCBI): 18596
• RRID: AB_3671924
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P05622-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Platelet-derived growth Factor Receptor Beta (PDGFRβ) is a member of the receptor tyrosine kinase family of proteins, which plays a crucial role in various physiological and pathological conditions.