PDHA2/PDHA1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PDHA2/PDHA1 Polyclonal antibody, PBS Only (17134-1-PBS)

• 

  WB analysis using 17134-1-AP (same clone as 17134-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17134-1-AP (PDHA2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17134-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 17134-1-AP (same clone as 17134-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 17134-1-AP (PDHA2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17134-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 17134-1-AP (same clone as 17134-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 17134-1-AP (PDHA2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17134-1-PBS in a different storage buffer formulation.

PDHA2/PDHA1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17134-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

PDHA2, EC:1.2.4.1, PDHA 2, PDHAL, PDHE1 A type II

---

Product Information

17134-1-PBS targets PDHA2/PDHA1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10882

  Product name: Recombinant human PDHA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-388 aa of BC030697

  Sequence: MLAAFISRVLRRVAQKSARRVLVASRNSSNDATFEIKKCDLYLLEEGPPVTTVLTRAEGLKYYRMMLTVRRMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHGVCYTRGLSVRSILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICENNLYGMGTSTERAAASPDYYKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQFATTDPEPHLEELGHHIYSSDSSFEVRGANPWIKFKSVS

• Full Name: pyruvate dehydrogenase (lipoamide) alpha 2
• Calculated Molecular Weight: 388 aa, 43 kDa
• Observed Molecular Weight: 40-43 kDa
• GenBank Accession Number: BC030697
• Gene Symbol: PDHA2
• Gene ID (NCBI): 5161
• RRID: AB_2878352
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29803
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PDHA2 (Pyruvate Dehydrogenase E1 Subunit Alpha 2) is a testis-specific mitochondrial enzyme encoded by the PDHA2 gene on human chromosome 4q22.3. The gene exhibits 84% nucleotide sequence similarity with the X-linked PDHA1, supporting the hypothesis that PDHA2 originated through retrotransposition of PDHA1 to an autosomal location. This antibody can recognize both PDHA2 and PDHA1.