PDHX Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PDHX Polyclonal antibody, PBS Only (10951-1-PBS)

• 

  WB analysis using 10951-1-AP (same clone as 10951-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10951-1-AP (PDHX antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10951-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 10951-1-AP (same clone as 10951-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10951-1-AP (PDHX antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10951-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SKOV-3 using 10951-1-AP (same clone as 10951-1-PBS)

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 10951-1-AP (PDHX antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10951-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 10951-1-AP (same clone as 10951-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10951-1-AP (PDHX antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10951-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 10951-1-AP (same clone as 10951-1-PBS)

  IP result of anti-PDHX (IP:10951-1-AP, 4ug; Detection:10951-1-AP 1:5000) with HEK-293 cells lysate 2000ug. This data was developed using the same antibody clone with 10951-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 10951-1-AP (same clone as 10951-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 10951-1-AP (PDHX antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 10951-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PDHX Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 10951-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

PDX1, pyruvate dehydrogenase complex, component X, Lipoyl-containing pyruvate dehydrogenase complex component X, E3-binding protein, E3 binding protein

---

Product Information

10951-1-PBS targets PDHX in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1389

  Product name: Recombinant human PDHX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-501 aa of BC010389

  Sequence: MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATVKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSFKANLENPIRLA

• Full Name: pyruvate dehydrogenase complex, component X
• Calculated Molecular Weight: 54 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC010389
• Gene Symbol: PDHX
• Gene ID (NCBI): 8050
• RRID: AB_2163102
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00330
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PDHX (Pyruvate dehydrogenase protein X component), an E3-binding protein in the PDC, is acetylated by the p300 at Lys 488, impeding the interaction between PDHX and dihydrolipoyl transacetylase (E2), thereby disrupting PDC assembly to inhibit its activation (PMID: 30012170). PDHX was characterized as a metabolically essential gene for esophageal squamous cell carcinoma (ESCC), and knockdown of PDHX inhibited the proliferation of cancer stem cells (CSCs) and in vivo tumor growth (PMID: 33964039). Western blot analysis detected PDHX at an apparent molecular mass of 54 kDa.