Filter: AllWBIPIHC

WB analysis using 18262-1-AP (same clone as 18262-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 18262-1-AP (PDK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18262-1-PBS in a different storage buffer formulation.
WB analysis using 18262-1-AP (same clone as 18262-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 18262-1-AP (PDK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18262-1-PBS in a different storage buffer formulation.
WB analysis using 18262-1-AP (same clone as 18262-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 18262-1-AP (PDK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18262-1-PBS in a different storage buffer formulation.
IP experiment of SiHa using 18262-1-AP (same clone as 18262-1-PBS)
IP result of anti-PDK1 (IP:18262-1-AP, 4ug; Detection:18262-1-AP 1:3000) with SiHa cells lysate 1520 ug. This data was developed using the same antibody clone with 18262-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 18262-1-AP (same clone as 18262-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18262-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 18262-1-AP (same clone as 18262-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18262-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 18262-1-AP (same clone as 18262-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18262-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 18262-1-AP (same clone as 18262-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18262-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 18262-1-AP (same clone as 18262-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18262-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 18262-1-AP (same clone as 18262-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18262-1-PBS in a different storage buffer formulation.
IHC staining of mouse kidney using 18262-1-AP (same clone as 18262-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18262-1-PBS in a different storage buffer formulation.
IHC staining of mouse kidney using 18262-1-AP (same clone as 18262-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18262-1-PBS in a different storage buffer formulation.
IHC staining of rat kidney using 18262-1-AP (same clone as 18262-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18262-1-PBS in a different storage buffer formulation.
IHC staining of rat kidney using 18262-1-AP (same clone as 18262-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18262-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 18262-1-AP (same clone as 18262-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart slide using 18262-1-AP (PDK1 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 18262-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 18262-1-AP (same clone as 18262-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart slide using 18262-1-AP (PDK1 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 18262-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

PDK1 Polyclonal antibody, PBS Only

PDK1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 18262-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial, EC:2.7.11.2, PDH kinase 1, PDHK1

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

18262-1-PBS targets PDK1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag13121 Product name: Recombinant human PDK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-436 aa of BC039158 Sequence: MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA Predict reactive species
Full Name	pyruvate dehydrogenase kinase, isozyme 1
Calculated Molecular Weight	436 aa, 49 kDa
Observed Molecular Weight	46-55 kDa
GenBank Accession Number	BC039158
Gene Symbol	PDK1
Gene ID (NCBI)	5163
RRID	AB_10598310
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q15118
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

PDK1(pyruvate dehydrogenase kinase isoform 1) is also named as PDHK1 and belongs to the PDK/BCKDK protein kinase family. It inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism (PMID:17683942). Starvation increases islet PDK activity (PMID:11723055). PDK1 has 2 isoforms with the MW of 49 and 52 kD, and a 28aa-transit-peptide in the N-terminal can be removed in the mature form. This antibody is specific to PDK1.