PDP2 Polyclonal antibody

• 

  WB analysis of mouse skeletal muscle using 13404-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 13404-1-AP (PDP2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 13404-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13404-1-AP (PDP2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 13404-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13404-1-AP (PDP2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 13404-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13404-1-AP (PDP2 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of mouse brain using 13404-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13404-1-AP (PDP2 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human lymphoma using 13404-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 13404-1-AP (PDP2 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human lymphoma using 13404-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 13404-1-AP (PDP2 Antibody) at dilution of 1:50 (under 40x lens).

PDP2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13404-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

KIAA1348, PDP 2, PDP2, PDPC 2

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, HeLa cells, mouse kidney tissue
• Positive IHC detected in: mouse brain tissue, human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

13404-1-AP targets PDP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4257

  Product name: Recombinant human PDP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 279-527 aa of BC028030

  Sequence: LHVANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGDVQLKWSKELQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSNEDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGEMEAERLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYK

• Full Name: pyruvate dehydrogenase phosphatase isoenzyme 2
• Calculated Molecular Weight: 529 aa, 60 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC028030
• Gene Symbol: PDP2
• Gene ID (NCBI): 57546
• RRID: AB_10639505
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P2J9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDP2, is the Ca2+-insensitive isoform of pyruvate dehydrogenase phosphataseis and found in liver and adipose tissue. In adipose tissue,insulin reduces the concentration dependence of PDP2 activity for Mg2+(PMID:12676647).It catalyzes the dephosphorylation and concomitant reactivation of the mitochondrial pyruvate dehydrogenase multienzyme complex.It can be detected the mature (52 kDa) and the immature (60 kDa) bands in western blot.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Dev Cell; Rheb mediates neuronal-activity-induced mitochondrial energetics through mTORC1-independent PDH activation.; Authors - Wanchun Yang
human	WB	Nat Commun; Lin28/let-7 axis regulates aerobic glycolysis and cancer progression via PDK1.; Authors - Xiaoyu Ma