PDS5A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PDS5A Polyclonal antibody, PBS Only (17485-1-PBS)

• 

  WB analysis using 17485-1-AP (same clone as 17485-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17485-1-AP (PDS5A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17485-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 17485-1-AP (same clone as 17485-1-PBS)

  WB result of PDS5A antibody (17485-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PDS5A transfected HEK-293 cells. This data was developed using the same antibody clone with 17485-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 17485-1-AP (same clone as 17485-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 17485-1-AP (PDS5A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17485-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 17485-1-AP (same clone as 17485-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17485-1-AP (PDS5A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17485-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 17485-1-AP (same clone as 17485-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 17485-1-AP (PDS5A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17485-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 17485-1-AP (same clone as 17485-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 17485-1-AP (PDS5A Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17485-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 17485-1-AP (same clone as 17485-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 17485-1-AP (PDS5A Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17485-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 17485-1-AP (same clone as 17485-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 17485-1-AP (PDS5A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17485-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 17485-1-AP (same clone as 17485-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using PDS5A antibody (17485-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 17485-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PDS5A Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 17485-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

SCC112, SCC 112, PIG54, PDS5, KIAA0648

---

Product Information

17485-1-PBS targets PDS5A in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11525

  Product name: Recombinant human PDS5A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-378 aa of BC009650

  Sequence: VKERRAHARQCLLKNISIRREYIKQNPMATEKLLSLLPEYVVPYMIHLLAHDPDFTRSQDVDQLRDIKECLWFMLEVLMTKNENNSHAFMKKMAENIKLTRDAQSPDESKTNEKLYTVCDVALCVINSKSALCNADSPKDPVLPMKFFTQPEKDFCNDKSYISEETRVLLLTGKPKPAGVLGAVNKPLSATGRKPYVRSTGTETGSNINVNSELNPSTGNRSREQSSEAAETGVSENEENPVRIISVTPVKNIDPVKNKEINSDQATQGNISSDRGKKRTVTAAGAENIQQKTDEKVDESGPPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQESPGGLEAGNAKAPKLQDLAKKAAPAERQIDLQR

• Full Name: PDS5, regulator of cohesion maintenance, homolog A (S. cerevisiae)
• Calculated Molecular Weight: 1297 aa, 147 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC009650
• Gene Symbol: PDS5A
• Gene ID (NCBI): 23244
• RRID: AB_2162088
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q29RF7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.