Product Information
26236-1-PBS targets PDZD11 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23975 Product name: Recombinant human PDZD11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 69-140 aa of BC012996 Sequence: QLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH Predict reactive species |
| Full Name | PDZ domain containing 11 |
| GenBank Accession Number | BC012996 |
| Gene Symbol | PDZD11 |
| Gene ID (NCBI) | 51248 |
| RRID | AB_3742175 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5EBL8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
PDZ Domain Containing 11 (PDZD11), a small protein widely expressed in the body, is mainly comprised of a single PDZ domain. PDZD11 has often been reported to be associated with the adherens junction (AJ) of epithelial cells. PDZD11 binds nectins to the cadherin-and cytoskeleton-related protein complex by interacting with PLEKHA7 to stabilize the nexins at AJs and promotes efficient early assembly of junctions.(PMID: 38766598,PMID: 35714771)



