Home
Products
Primary Antibodies
PEA15 Polyclonal antibody, PBS Only (21446-1-PBS)

Filter: AllWBIHC

WB analysis of fetal human brain using 21446-1-AP (same clone as 21446-1-PBS)
fetal human brain tissue were subjected to SDS PAGE followed by western blot with 21446-1-AP (PEA15 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21446-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 21446-1-AP (same clone as 21446-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21446-1-AP (PEA15 antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21446-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 21446-1-AP (same clone as 21446-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21446-1-AP (PEA15 antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21446-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 21446-1-AP (same clone as 21446-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21446-1-AP (PEA15 antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21446-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 21446-1-AP (same clone as 21446-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 21446-1-AP (PEA15 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21446-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 21446-1-AP (same clone as 21446-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 21446-1-AP (PEA15 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21446-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 21446-1-AP (same clone as 21446-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 21446-1-AP (PEA15 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21446-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 21446-1-AP (same clone as 21446-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 21446-1-AP (PEA15 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21446-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

PEA15 Polyclonal antibody, PBS Only

Name: PEA15 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 21446-1-PBS

PEA15 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21446-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

21446-1-PBS targets PEA15 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag13782 Product name: Recombinant human PEA15 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-130 aa of BC002426 Sequence: MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA Predict reactive species
Full Name	phosphoprotein enriched in astrocytes 15
Calculated Molecular Weight	130 aa, 15 kDa
Observed Molecular Weight	15-18 kDa
GenBank Accession Number	BC002426
Gene Symbol	PEA15
Gene ID (NCBI)	8682
RRID	AB_2878858
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q15121
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.