Product Information
88106-1-PBS targets PEBP1/RKIP in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag0864 Product name: Recombinant human PEBP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 83-187 aa of BC008714 Sequence: EWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK Predict reactive species |
| Full Name | phosphatidylethanolamine binding protein 1 |
| Calculated Molecular Weight | 21 kDa |
| Observed Molecular Weight | 23 kDa |
| GenBank Accession Number | BC008714 |
| Gene Symbol | PEBP1 |
| Gene ID (NCBI) | 5037 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P30086 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Raf kinase inhibitor protein (RKIP), also termed phosphatidylethanolamine binding protein PEBP1, was initially identified as a potent inhibitor of Raf-1/MEK/ERK, NF-kB, and G-protein-coupled receptor signaling pathways. Later RKIP has been further identified as a metastasis suppressor and its loss of expression has been reported in various cancers. Its expression has been proposed as a prognostic marker for patients diagnosed with the above cancers.
