PEBP1/RKIP Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PEBP1/RKIP Recombinant monoclonal antibody (88106-1-RR)

PEBP1/RKIP Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 88106-1-RR

Clone No.260328F7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

PEBP1, RKIP, HCNP, HCNPpp, Neuropolypeptide h3

• 

  WB analysis using 88106-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88106-1-RR (PEBP1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 88106-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88106-1-RR (PEBP1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, Neuro-2a cells, HL-60 cells, mouse brain tissue, fetal human brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

88106-1-RR targets PEBP1/RKIP in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0864

  Product name: Recombinant human PEBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 83-187 aa of BC008714

  Sequence: EWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

• Full Name: phosphatidylethanolamine binding protein 1
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC008714
• Gene Symbol: PEBP1
• Gene ID (NCBI): 5037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30086
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Raf kinase inhibitor protein (RKIP), also termed phosphatidylethanolamine binding protein PEBP1, was initially identified as a potent inhibitor of Raf-1/MEK/ERK, NF-kB, and G-protein-coupled receptor signaling pathways. Later RKIP has been further identified as a metastasis suppressor and its loss of expression has been reported in various cancers. Its expression has been proposed as a prognostic marker for patients diagnosed with the above cancers.