CoraLite® Plus 488-conjugated Serpin F1/PEDF Monoclonal antibody

Serpin F1/PEDF Monoclonal Antibody for WB
Cat No. CL488-66554
Clone No.2C5C8

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB

PIG35, PEDF, EPC-1, EPC 1, Cell proliferation-inducing gene 35 protein

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig plasma, human plasma

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66554 targets Serpin F1/PEDF in WB applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26660

Product name: Recombinant human SERPINF1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 282-403 aa of BC013984

Sequence: VTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDT

Predict reactive species
Full Name serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1
Calculated Molecular Weight 418 aa, 46 kDa
Observed Molecular Weight 46-50 kDa
GenBank Accession NumberBC013984
Gene Symbol PEDF
Gene ID (NCBI) 5176
RRIDAB_3084258
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP36955
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PEDF also known as serpin F1 (SERPINF1), is a multifunctional secreted protein that has anti-angiogenic, anti-tumorigenic, and neurotrophic functionsis. It is an approximately 50-kDa secreted protein that is widely expressed, including by osteoblasts and osteoclasts. PEDF is also one of the most abundant secretory products of adipocytes, and circulating concentrations of PEDF correlate positively with body fat mass and INS resistance. PEDF is a neurotrophic factor involved in neuronal differentiation in retinoblastoma cells. Mutations in this gene were found in individuals with osteogenesis imperfecta, type VI.

Protocols

Product Specific Protocols
WB protocol for CL Plus 488 Serpin F1/PEDF antibody CL488-66554Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...