Home
Products
Primary Antibodies
PELO Polyclonal antibody, PBS Only (10582-1-PBS)

Filter: AllWBIPIHCIF/ICC

WB analysis using 10582-1-AP (same clone as 10582-1-PBS)
Various cells were subjected to SDS PAGE followed by western blot with 10582-1-AP (PELO antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10582-1-PBS in a different storage buffer formulation.
WB analysis of mouse testis using 10582-1-AP (same clone as 10582-1-PBS)
mouse testis tissue were subjected to SDS PAGE followed by western blot with 10582-1-AP (PELO antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10582-1-PBS in a different storage buffer formulation.
WB analysis using 10582-1-AP (same clone as 10582-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 10582-1-AP (PELO antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10582-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 10582-1-AP (same clone as 10582-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 10582-1-AP (PELO antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10582-1-PBS in a different storage buffer formulation.
WB analysis of mouse testis using 10582-1-AP (same clone as 10582-1-PBS)
mouse testis tissue were subjected to SDS PAGE followed by western blot with 10582-1-AP (PELO antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10582-1-PBS in a different storage buffer formulation.
WB analysis of HEK-293 using 10582-1-AP (same clone as 10582-1-PBS)
HEK-293 cells were subjected to SDS PAGE followed by western blot with 10582-1-AP (PELO antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10582-1-PBS in a different storage buffer formulation.
IP experiment of HEK-293 using 10582-1-AP (same clone as 10582-1-PBS)
IP result of anti-PELO (IP:10582-1-AP, 4ug; Detection:10582-1-AP 1:500) with HEK-293 cells lysate 1200ug. This data was developed using the same antibody clone with 10582-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 10582-1-AP (same clone as 10582-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10582-1-AP (PELO antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10582-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 10582-1-AP (same clone as 10582-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10582-1-AP (PELO antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10582-1-PBS in a different storage buffer formulation.
IHC staining of human ovary cancer using 10582-1-AP (same clone as 10582-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 10582-1-AP (PELO antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10582-1-PBS in a different storage buffer formulation.
IHC staining of mouse pancreas using 10582-1-AP (same clone as 10582-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 10582-1-AP (PELO antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10582-1-PBS in a different storage buffer formulation.
IHC staining of rat ovary using 10582-1-AP (same clone as 10582-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat ovary tissue slide using 10582-1-AP (PELO antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10582-1-PBS in a different storage buffer formulation.
IHC staining of mouse stomach using 10582-1-AP (same clone as 10582-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 10582-1-AP (PELO antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10582-1-PBS in a different storage buffer formulation.
IHC staining of mouse ovary using 10582-1-AP (same clone as 10582-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 10582-1-AP (PELO antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10582-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 10582-1-AP (same clone as 10582-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PELO antibody (10582-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 10582-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

PELO Polyclonal antibody, PBS Only

Name: PELO Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 10582-1-PBS

PELO Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 10582-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

CGI 17, CGI-17, hPelota, PRO1770, Protein Dom34 homolog

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

10582-1-PBS targets PELO in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag0873 Product name: Recombinant human PELO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 42-384 aa of BC005889 Sequence: STIRKVQTESSTGSVGSNRVRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASPGFVREQFCDYMFQQAVKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEE Predict reactive species
Full Name	pelota homolog (Drosophila)
Calculated Molecular Weight	43 kDa
Observed Molecular Weight	43-45 kDa
GenBank Accession Number	BC005889
Gene Symbol	PELO
Gene ID (NCBI)	53918
RRID	AB_2236833
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9BRX2
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

The Pelo gene was originally identified in a mutagenesis screen for spermatogenesis-specific genes of Drosophila melanogaster. The PELO is required for the meiotic division during the G2/M transition, and functions in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs [PMID:12556505]. It may participate in the machinery of protein synthesis or in the regulation of mRNA translation [PMID:9584085].