PEX11G Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PEX11G Polyclonal antibody, PBS Only (15744-1-PBS)

• 

  WB analysis of human testis using 15744-1-AP (same clone as 15744-1-PBS)

  human testis tissue was subjected to SDS PAGE followed by western blot with 15744-1-AP (PEX11G antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15744-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15744-1-AP (same clone as 15744-1-PBS)

  PC-12 cells were subjected to SDS PAGE followed by western blot with 15744-1-AP (PEX11G antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15744-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 15744-1-AP (same clone as 15744-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 15744-1-AP (PEX11G antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15744-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 15744-1-AP (same clone as 15744-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 15744-1-AP (PEX11G antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15744-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 15744-1-AP (same clone as 15744-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 15744-1-AP (PEX11G antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15744-1-PBS in a different storage buffer formulation.

PEX11G Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15744-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15744-1-PBS targets PEX11G in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8179

  Product name: Recombinant human PEX11G protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-241 aa of BC008780

  Sequence: MASLSGLASALESYRGRDRLIRVLGYCCQLVGGVLVEQCPARSEVGTRLLVVSTQLSHCRTILRLFDDLAMFVYTKQYGLGAQEEDAFVRCVSVLGNLADQLYYPCEHVAWAADARVLHVDSSRWWTLSTTLWALSLLLGVARSLWMLLKLRQRLRSPTAPFTSPLPRGKRRAMEAQMQSEALSLLSNLADLANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSMYQAARAGGQAEATTP

• Full Name: peroxisomal biogenesis factor 11 gamma
• Calculated Molecular Weight: 241 aa, 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC008780
• Gene Symbol: PEX11G
• Gene ID (NCBI): 92960
• RRID: AB_2162132
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96HA9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.