PEX19 Monoclonal antibody, PBS Only

PEX19 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 68555-1-PBS
Clone No.3H2C2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IF/ICC, Indirect ELISA

PMPI, PMP1, PEX, Peroxin-19, OK/SW-cl.22

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68555-1-PBS targets PEX19 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6858

Product name: Recombinant human PEX19 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-299 aa of BC000496

Sequence: MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQCLIM

Predict reactive species
Full Name peroxisomal biogenesis factor 19
Calculated Molecular Weight 33 kDa
Observed Molecular Weight 35-40 kDa
GenBank Accession NumberBC000496
Gene Symbol PEX19
Gene ID (NCBI) 5824
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP40855
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. PEX19 gene is necessary for early peroxisomal biogenesis. It acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs) (PMID: 14709540). PEX19 may bind newly synthesized PMPs and facilitate their insertion into the peroxisome membrane (PMID: 107044440. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. Defects in this gene are a cause of Zellweger syndrome (ZWS), as well as peroxisome biogenesis disorder complementation group 14 (PBD-CG14) (PMID:20683989) (PMID:10051604).

Loading...
||
New chat Able
正在加载,请稍候...