• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated PEX5 Polyclonal antibody

PEX5 Polyclonal Antibody for
Cat No. CL647-12545

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

Cell and organelle markers, FLJ50634, FLJ50721, FLJ51948, Peroxin 5, Peroxisome Marker, Peroxisome receptor 1, PEX5, PTS1 BP, PTS1 receptor, PTS1R, PXR1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL647-12545 targets PEX5 in applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3268

Product name: Recombinant human PEX5 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 340-639 aa of BC010621

Sequence: EGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ

Predict reactive species
Full Name peroxisomal biogenesis factor 5
Calculated Molecular Weight 631 aa, 70 kDa
Observed Molecular Weight 68-80 kDa
GenBank Accession NumberBC010621
Gene Symbol PEX5
Gene ID (NCBI) 5830
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP50542
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The peroxisomal targeting signal type1 (PTS1) receptor, PEX5, is one member of peroxins (PEXs) which are proteins required for peroxisome assembly. PEX5 and PEX7 function as receptors that recognize PTS1- and PTS2- containing proteins, respectively, and PEX5 binds PTS1 through its C-terminal 40-kDa tetratricopeptide repeat domain. It is a predominantly cytoplasmic, partly peroxisomal protein that appears to shuttle between these compartments as it mediates the import of PTS1-containing proteins. PEX5 has been reported to interact with PEX10, PEX12, PEX13, and PEX14. Defects in PEX5 are a cause of Zellweger syndrome (ZWS), which is a lethal peroxisome biogenesis disorder. This antibody recognizes endogenous PEX5, which migrates with an apparent molecular mass of 80 kDa (PMID: 7790377).

Loading...
||
New chat

Able

正在加载,请稍候...