PFDN1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PFDN1 Polyclonal antibody, PBS Only (11033-2-PBS)

• 

  WB analysis of human brain using 11033-2-AP (same clone as 11033-2-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 11033-2-AP (PFDN1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11033-2-PBS in a different storage buffer formulation.

• 

  WB analysis of human colon using 11033-2-AP (same clone as 11033-2-PBS)

  human colon tissue were subjected to SDS PAGE followed by western blot with 11033-2-AP (PFDN1 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11033-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 11033-2-AP (same clone as 11033-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 11033-2-AP (PFDN1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11033-2-PBS in a different storage buffer formulation.

PFDN1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11033-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

11033-2-PBS targets PFDN1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1506

  Product name: Recombinant human PFDN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-122 aa of BC011869

  Sequence: MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ

• Full Name: prefoldin subunit 1
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC011869
• Gene Symbol: PFDN1
• Gene ID (NCBI): 5201
• RRID: AB_2283690
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60925
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.