PFDN2 Polyclonal antibody

• 

  WB analysis of L02 using 13053-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 13053-1-AP (PFDN2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Neuro-2a using 13053-1-AP

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 13053-1-AP (PFDN2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 13053-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 13053-1-AP (PFDN2 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human liver cancer using 13053-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13053-1-AP (PFDN2 antibody) at dilution of 1:50 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 13053-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13053-1-AP (PFDN2 antibody) at dilution of 1:50 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of L02 using 13053-1-AP

  Immunofluorescent analysis of L02 cells using 13053-1-AP (PFDN2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

PFDN2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13053-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PFD2, HSPC231

---

Tested Applications

• Positive WB detected in: L02 cells, Neuro-2a cells
• Positive IHC detected in: human lung cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13053-1-AP targets PFDN2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3720

  Product name: Recombinant human PFDN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-154 aa of BC012464

  Sequence: MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS

• Full Name: prefoldin subunit 2
• Calculated Molecular Weight: 154 aa, 17 kDa
• Observed Molecular Weight: 17-20 kDa
• GenBank Accession Number: BC012464
• Gene Symbol: PFDN2
• Gene ID (NCBI): 5202
• RRID: AB_2877905
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHV9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.