PFDN2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PFDN2 Polyclonal antibody, PBS Only (13053-1-PBS)

• 

  WB analysis of L02 using 13053-1-AP (same clone as 13053-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 13053-1-AP (PFDN2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13053-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Neuro-2a using 13053-1-AP (same clone as 13053-1-PBS)

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 13053-1-AP (PFDN2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13053-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 13053-1-AP (same clone as 13053-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 13053-1-AP (PFDN2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 13053-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 13053-1-AP (same clone as 13053-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13053-1-AP (PFDN2 antibody) at dilution of 1:50 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13053-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 13053-1-AP (same clone as 13053-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13053-1-AP (PFDN2 antibody) at dilution of 1:50 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13053-1-PBS in a different storage buffer formulation.

• 

  IF Staining of L02 using 13053-1-AP (same clone as 13053-1-PBS)

  Immunofluorescent analysis of L02 cells using 13053-1-AP (PFDN2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13053-1-PBS in a different storage buffer formulation.

PFDN2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13053-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

13053-1-PBS targets PFDN2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3720

  Product name: Recombinant human PFDN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-154 aa of BC012464

  Sequence: MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS

• Full Name: prefoldin subunit 2
• Calculated Molecular Weight: 154 aa, 17 kDa
• Observed Molecular Weight: 17-20 kDa
• GenBank Accession Number: BC012464
• Gene Symbol: PFDN2
• Gene ID (NCBI): 5202
• RRID: AB_2877905
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHV9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.