PFDN4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PFDN4 Polyclonal antibody, PBS Only (16045-1-PBS)

• 

  WB analysis using 16045-1-AP (same clone as 16045-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16045-1-AP (PFDN4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16045-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 16045-1-AP (same clone as 16045-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16045-1-AP (PFDN4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16045-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 16045-1-AP (same clone as 16045-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16045-1-AP (PFDN4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16045-1-PBS in a different storage buffer formulation.

PFDN4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16045-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

16045-1-PBS targets PFDN4 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8938

  Product name: Recombinant human PFDN4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-134 aa of BC010953

  Sequence: MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES

• Full Name: prefoldin subunit 4
• Calculated Molecular Weight: 134 aa, 15 kDa
• Observed Molecular Weight: 15-20 kDa
• GenBank Accession Number: BC010953
• Gene Symbol: PFDN4
• Gene ID (NCBI): 5203
• RRID: AB_2162573
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQP4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The human PFDN4, prefoldin 4, is a subunit of the heterohexameric chaperone protein and belongs to the prefoldin family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. Previous reports have shown that PFDN4 is upregulated in breast cancer cell lines and tumor tissues (PMID: 11381030; PMID: 9630229). PFDN4 expression may be a prognostic factor in colorectal cancer (PMID: 20552408).