PFKFB3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87233-1-RR (same clone as 87233-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87233-1-RR (PFKFB3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87233-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat thymus using 87233-1-RR (same clone as 87233-1-PBS)

  Rat thymus tissue were subjected to SDS PAGE followed by western blot with 87233-1-RR (PFKFB3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87233-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 87233-1-RR (same clone as 87233-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using PFKFB3 antibody (87233-1-RR, Clone: 252490B6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 87233-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87233-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87233-1-RR against Human PFKFB3 were performed. The affinity constant is 0.227 nM.

PFKFB3 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 87233-1-PBS

Clone No.252490B6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

6PF-2-K/Fru-2,6-P2ase 3, 6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme, 6-phosphofructo-2-kinase, 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3, Fructose-2,6-bisphosphatase

---

Product Information

87233-1-PBS targets PFKFB3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4744

  Product name: Recombinant human PFKFB3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 243-520 aa of BC040482

  Sequence: HVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH

• Full Name: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
• Calculated Molecular Weight: 520 aa, 60 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC040482
• Gene Symbol: PFKFB3
• Gene ID (NCBI): 5209
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16875
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PFKFB3, also named as NY-REN-56 and iPFK-2, plays a role in glucose metabolism. Its synthesis and degradation of fructose 2,6-bisphosphate. Endogenously generated adenosine cooperates with bacterial components to increase PFKFB3 isozyme activity, resulting in greater fructose 2,6-bisphosphate accumulation. PFKFB3 is required for increased growth, metabolic activity and is regulated through active JAK2 and STAT5.