PFKM Recombinant monoclonal antibody, PBS Only (Detector)

PFKM Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 84281-5-PBS
Clone No.241598B2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

241598B2, 6-phosphofructokinase type A, ATP-dependent 6-phosphofructokinase, muscle type, ATP-PFK, EC:2.7.1.11

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84281-5-PBS targets PFKM as part of a matched antibody pair:

MP01204-3: 84281-4-PBS capture and 84281-5-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag30840

Product name: Recombinant human PFKM protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 675-725 aa of BC021203

Sequence: FATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVAE

Predict reactive species
Full Name phosphofructokinase, muscle
Observed Molecular Weight 75-85 kDa
GenBank Accession NumberBC021203
Gene Symbol PFKM
Gene ID (NCBI) 5213
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP08237
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PFKM, also named as GSD7, PFK-1, PFK-M and PFKX, belongs to the phosphofructokinase family and two domains subfamily. PFKM catalyzes the reaction: ATP + D-fructose 6-phosphate = ADP + D-fructose 1,6-bisphosphate. It is a key regulatory enzyme in glycolysis. Defects in PFKM cause glycogen storage disease type 7 (GSD7). PFKM has three isoforms with molecular weights of 85, 82, and 93 kDa.

Loading...
||
New chat Able
正在加载,请稍候...