PFKM Recombinant monoclonal antibody

• 

  WB analysis using 84281-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84281-5-RR (PFKM antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 84281-5-RR

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 84281-5-RR (PFKM antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse skeletal muscle using 84281-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 84281-5-RR (PFKM antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 84281-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 84281-5-RR (PFKM antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 84281-5-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using PFKM antibody (84281-5-RR, Clone: 241598B2 ) at dilution of 1:500 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

• 

  IF Staining of HepG2 using 84281-5-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PFKM antibody (84281-5-RR, Clone: 241598B2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 84281-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84281-5-RR against Human PFKM were performed. The affinity constant is 3.01 nM.

PFKM Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 84281-5-RR

Clone No.241598B2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PFK A, EC:2.7.1.11, ATP-PFK, ATP-dependent 6-phosphofructokinase, muscle type, 6-phosphofructokinase type A

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse skeletal muscle tissue, PC-3 cells, Raji cells
• Positive IHC detected in: mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84281-5-RR targets PFKM in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag30840

  Product name: Recombinant human PFKM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 675-725 aa of BC021203

  Sequence: FATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVAE

• Full Name: phosphofructokinase, muscle
• Observed Molecular Weight: 75-85 kDa
• GenBank Accession Number: BC021203
• Gene Symbol: PFKM
• Gene ID (NCBI): 5213
• RRID: AB_3671827
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P08237
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PFKM, also named as GSD7, PFK-1, PFK-M and PFKX, belongs to the phosphofructokinase family and two domains subfamily. PFKM catalyzes the reaction: ATP + D-fructose 6-phosphate = ADP + D-fructose 1,6-bisphosphate. It is a key regulatory enzyme in glycolysis. Defects in PFKM cause glycogen storage disease type 7 (GSD7). PFKM has three isoforms with molecular weights of 85, 82, and 93 kDa.