PFN2 Monoclonal antibody

• 

  WB analysis of human brain using 60094-1-Ig

  human brain tissue were subjected to SDS PAGE followed by western blot with 60094-1-Ig (PFN2 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 60094-1-Ig

  human brain tissue were subjected to SDS PAGE followed by western blot with 60094-1-Ig (PFN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 60094-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney using 60094-1-Ig(PFN2 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human kidney using 60094-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney using 60094-1-Ig(PFN2 antibody) at dilution of 1:100 (under 40x lens).

PFN2 Monoclonal Antibody for ELISA

Cat No. 60094-1-Ig

Clone No.1D9C4

Publications(2)

Host / Isotype

Mouse / IgM

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

---

Published Applications

• WB: See 2 publications below

Product Information

60094-1-Ig targets PFN2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Mouse / IgM
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5043

  Product name: Recombinant human PFN2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-140 aa of BC018049

  Sequence: MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

• Full Name: profilin 2
• Calculated Molecular Weight: 140 aa, 15 kDa
• GenBank Accession Number: BC018049
• Gene Symbol: PFN2
• Gene ID (NCBI): 5217
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35080
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncogene; Circadian regulator NR1D2 regulates glioblastoma cell proliferation and motility.; Authors - Min Yu
human	WB	Mol Cell Biochem; Comprehensive bioinformation analysis of the miRNA of PLCE1 knockdown in esophageal squamous cell carcinoma.; Authors - Xiaobin Cui