• Featured Product
  • KD/KO Validated

PGAM1 Monoclonal antibody, PBS Only (Capture)

PGAM1 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 67470-1-PBS
Clone No.2H2A9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

2H2A9, BPG-dependent PGAM 1, CDABP0006, EC:5.4.2.11, PGAM 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67470-1-PBS targets PGAM1 as part of a matched antibody pair:

MP51572-1: 67470-1-PBS capture and 67470-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9250

Product name: Recombinant human PGAM1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-254 aa of BC011678

Sequence: MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK

Predict reactive species
Full Name phosphoglycerate mutase 1 (brain)
Calculated Molecular Weight 254 aa, 29 kDa
Observed Molecular Weight 29 kDa
GenBank Accession NumberBC011678
Gene Symbol PGAM1
Gene ID (NCBI) 5223
RRIDAB_2882699
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP18669
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PGAM1(phosphoglycerate mutase 1) is also named as PGAMA,PGAM-B and belongs to the phosphoglycerate mutase family. Phosphoglycerate mutase is widely distributed in mammalian tissues where it catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. The homodimer PGAM1 is expressed mainly in liver, kidney, brain and overexpressed in a variety of human cancers, including breast carcinoma, colorectal cancer, lung cancer, prostate cancer, oral squamous cell carcinoma, esophageal squamous cell carcinomas and also associated with certain virus infection. PGAM1 could be developed as a useful diagnostic biomarker, as well as a potential therapeutic target for hepatocellular carcinoma (PMID:20403181). This antibody may also recognize PGAM2 and PGAM4 due to the high homology.

Loading...
||
New chat

Able

正在加载,请稍候...