• Featured Product
  • KD/KO Validated

PGAM1 Monoclonal antibody

PGAM1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67470-1-Ig
Clone No.2H2A9

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat and More (2)

Applications

WB, IHC, IF/ICC, ELISA

BPG dependent PGAM 1, PGAM B, PGAM1, PGAMA, Phosphoglycerate mutase 1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU2OS cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells, A549 cells, LNCaP cells, K-562 cells
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67470-1-Ig targets PGAM1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9250

Product name: Recombinant human PGAM1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-254 aa of BC011678

Sequence: MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK

Predict reactive species
Full Name phosphoglycerate mutase 1 (brain)
Calculated Molecular Weight 254 aa, 29 kDa
Observed Molecular Weight 29 kDa
GenBank Accession NumberBC011678
Gene Symbol PGAM1
Gene ID (NCBI) 5223
RRIDAB_2882699
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP18669
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PGAM1(phosphoglycerate mutase 1) is also named as PGAMA,PGAM-B and belongs to the phosphoglycerate mutase family. Phosphoglycerate mutase is widely distributed in mammalian tissues where it catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. The homodimer PGAM1 is expressed mainly in liver, kidney, brain and overexpressed in a variety of human cancers, including breast carcinoma, colorectal cancer, lung cancer, prostate cancer, oral squamous cell carcinoma, esophageal squamous cell carcinomas and also associated with certain virus infection. PGAM1 could be developed as a useful diagnostic biomarker, as well as a potential therapeutic target for hepatocellular carcinoma (PMID:20403181). This antibody may also recognize PGAM2 and PGAM4 due to the high homology.

Protocols

Product Specific Protocols
WB protocol for PGAM1 antibody 67470-1-IgDownload protocol
IHC protocol for PGAM1 antibody 67470-1-IgDownload protocol
IF protocol for PGAM1 antibody 67470-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human,mouseWB,IHC

J Nanobiotechnology

Tumor microenvironment-activated cancer cell membrane-liposome hybrid nanoparticle-mediated synergistic metabolic therapy and chemotherapy for non-small cell lung cancer.

Authors - Wei Zhang
  • KD Validated
humanIF

Oncol Res

Phosphoglycerate Mutase 1 (PGAM1) Promotes Pancreatic Ductal Adenocarcinoma (PDAC) Metastasis by Acting as a Novel Downstream Target of the PI3K/Akt/mTOR Pathway

Authors - Xinlu Liu
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...