PGAM5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PGAM5 Polyclonal antibody, PBS Only (28445-1-PBS)

• 

  WB analysis using 28445-1-AP (same clone as 28445-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28445-1-AP (PGAM5 antibody) at dilution of 1:7000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28445-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 28445-1-AP (same clone as 28445-1-PBS)

  WB result of PGAM5 antibody (28445-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PGAM5 transfected LNCaP cells. This data was developed using the same antibody clone with 28445-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 28445-1-AP (same clone as 28445-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28445-1-AP (PGAM5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28445-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 28445-1-AP (same clone as 28445-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28445-1-AP (PGAM5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28445-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 28445-1-AP (same clone as 28445-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28445-1-AP (PGAM5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28445-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 28445-1-AP (same clone as 28445-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28445-1-AP (PGAM5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28445-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 28445-1-AP (same clone as 28445-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 28445-1-AP (PGAM5 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28445-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 28445-1-AP (same clone as 28445-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 28445-1-AP (PGAM5 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28445-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 28445-1-AP (same clone as 28445-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using PGAM5 antibody (28445-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 28445-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PGAM5 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 28445-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Bcl-XL-binding protein v68, BXLBv68, EC:3.1.3.16, Serine/threonine-protein phosphatase PGAM5, mitochondrial

---

Product Information

28445-1-PBS targets PGAM5 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28195

  Product name: Recombinant human PGAM5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-255 aa of BC008196

  Sequence: MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCSIPPLLSAGDFVVLGS

• Full Name: phosphoglycerate mutase family member 5
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC008196
• Gene Symbol: PGAM5
• Gene ID (NCBI): 192111
• RRID: AB_2881143
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96HS1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Phosphoglycerate mutase 5 (PGAM5) is a mitochondrial Serine (Ser)/Threonine (Thr) phosphatase normally located in the inner mitochondrial membrane. Upon mitochondrial dysfunction, PGAM5 recruits and dephosphorylates Drp1 at Ser-637, triggers its GTPase activity and promotes mitochondrial fission. PGAM5 regulates mitophagy by stabilizing PINK1 under stress conditions, which recruits E3 ubiquitin ligase PARKIN for degradation of the damaged mitochondria. PGAM5 can be cleaved and released to the cytoplasm through PARKIN, which activates Wnt signaling and induces mitochondrial biogenesis (PMID: 32439975). PGAM5 has 2 isoforms with the molecular mass of 28 and 32 kDa.