PGLYRP1 Recombinant monoclonal antibody

• 

  WB analysis of human urine using 85610-4-RR

  human urine sample were subjected to SDS PAGE followed by western blot with 85610-4-RR (PGLYRP1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse spleen using 85610-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85610-4-RR (PGLYRP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 85610-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85610-4-RR (PGLYRP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse spleen using 85610-4-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using PGLYRP1 antibody (85610-4-RR, Clone: 243004F5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse spleen using 85610-4-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using PGLYRP1 antibody (85610-4-RR, Clone: 243004F5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PGLYRP1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 85610-4-RR

Clone No.243004F5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

PGLYRP, PGRP, PGRP S, PGRPS, PGRP-S

---

Tested Applications

• Positive WB detected in: human urine
• Positive IHC detected in: mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85610-4-RR targets PGLYRP1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3122

  Product name: Recombinant Human PGLYRP1 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-196 aa of NM_005091.2

  Sequence: QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP

• Full Name: peptidoglycan recognition protein 1
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: NM_005091.2
• Gene Symbol: PGLYRP1
• Gene ID (NCBI): 8993
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75594
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Peptidoglycan recognition protein 1 (PGLYRP1, also known as PGRP-S) belongs to a family of evolutionary conserved innate immunity proteins, which in mammals also include PGLYRP2, PGLYRP3, and PGLYRP4 (PMID: 17275309; 20418257). PGLYRP1 is highly expressed in polymorphonuclear leukocytes and to a lower extent in many non-immune cells (PMID: 20418257). It recognizes bacterial peptidoglycan and functions in antibacterial immunity and inflammation (PMID: 20418257). PGLYRP1 has been identified as a ligand for TREM-1 (PMID: 25595774).