Product Information
21134-1-PBS targets PGLYRP4 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15539 Product name: Recombinant human PGLYRP4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 18-113 aa of BC142636 Sequence: DSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKAWGAEAVGCSIQLTTPVNVLVIHHVPGLECHDQTVCSQRLRELQAHHVHNNSGC Predict reactive species |
| Full Name | peptidoglycan recognition protein 4 |
| Calculated Molecular Weight | 373 aa, 41 kDa |
| GenBank Accession Number | BC142636 |
| Gene Symbol | PGLYRP4 |
| Gene ID (NCBI) | 57115 |
| RRID | AB_2878817 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96LB8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



