Filter: AllIHC

IHC staining of rat skin using 21134-1-AP (same clone as 21134-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat skin tissue slide using 21134-1-AP (PGLYRP4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21134-1-PBS in a different storage buffer formulation.
IHC staining of mouse skin using 21134-1-AP (same clone as 21134-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 21134-1-AP (PGLYRP4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21134-1-PBS in a different storage buffer formulation.

PGLYRP4 Polyclonal antibody, PBS Only

Name: PGLYRP4 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 21134-1-PBS

PGLYRP4 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 21134-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

PGRPIB, Peptidoglycan recognition protein I-beta, PGLYRPIbeta, PGRP I beta, PGRP Ibeta

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

21134-1-PBS targets PGLYRP4 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag15539 Product name: Recombinant human PGLYRP4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 18-113 aa of BC142636 Sequence: DSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKAWGAEAVGCSIQLTTPVNVLVIHHVPGLECHDQTVCSQRLRELQAHHVHNNSGC Predict reactive species
Full Name	peptidoglycan recognition protein 4
Calculated Molecular Weight	373 aa, 41 kDa
GenBank Accession Number	BC142636
Gene Symbol	PGLYRP4
Gene ID (NCBI)	57115
RRID	AB_2878817
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q96LB8
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™