PGM2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PGM2 Polyclonal antibody, PBS Only (11022-1-PBS)

• 

  WB analysis using 11022-1-AP (same clone as 11022-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11022-1-AP (PGM2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11022-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 11022-1-AP (same clone as 11022-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 11022-1-AP (PGM2 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11022-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 11022-1-AP (same clone as 11022-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11022-1-AP (PGM2 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11022-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 11022-1-AP (same clone as 11022-1-PBS)

  IP result of anti-PGM2 (IP:11022-1-AP, 4ug; Detection:11022-1-AP 1:200) with HEK-293 cells lysate 2400 ug. This data was developed using the same antibody clone with 11022-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 11022-1-AP (same clone as 11022-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11022-1-AP (PGM2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11022-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 11022-1-AP (same clone as 11022-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11022-1-AP (PGM2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11022-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 11022-1-AP (same clone as 11022-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 11022-1-AP (PGM2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 11022-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PGM2 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 11022-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

11022-1-PBS targets PGM2 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1488

  Product name: Recombinant human PGM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 264-612 aa of BC010087

  Sequence: QSAFKAFDLVPPEAVPEQKDPDPEFPTVKYPNPEEGKGVLTLSFALADKTKARIVLANDPDADRLAVAEKQDSGEWRVFSGNELGALLGWWLFTSWKEKNQDRSALKDTYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVISAELASFLATKNLSLSQQLKAIYVEYGYHITKASYFICHDQETIKKLFENLRNYDGKNNYPKACGKFEISAIRDLTTGYDDSQPDKKAVLPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYAELCAPPGNSDPEQLKKELNELVSAIEEHFFQPQKYNLQPKAD

• Full Name: phosphoglucomutase 2
• Calculated Molecular Weight: 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC010087
• Gene Symbol: PGM2
• Gene ID (NCBI): 55276
• RRID: AB_2161422
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96G03
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.