Tested Applications
| Positive IF/ICC detected in | HEK-293 cells | 
| Positive FC (Intra) detected in | HEK-293 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-66372 targets PGRMC1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag3643 Product name: Recombinant human PGRMC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 43-195 aa of BC034238 Sequence: YKIVRGDQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND Predict reactive species | 
                                    
| Full Name | progesterone receptor membrane component 1 | 
| Calculated Molecular Weight | 195 aa, 22 kDa | 
| GenBank Accession Number | BC034238 | 
| Gene Symbol | PGRMC1 | 
| Gene ID (NCBI) | 10857 | 
| RRID | AB_3084240 | 
| Conjugate | CoraLite® Plus 488 Fluorescent Dye | 
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm | 
| Form | Liquid | 
| Purification Method | Protein G purification | 
| UNIPROT ID | O00264 | 
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. | 
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
Progesterone receptor membrane component 1 (PGRMC1) is a member of a multi-protein progesterone-binding complex. However, PGRMC1 shares homology with cytochrome b5-related proteins rather than hormone receptors (PMID: 18992768). It is a heme binding protein with biding sites for Src homology (SH2) and SH3 domain-containing proteins (PMID: 17583495). PGRMC1 is overexpressed in a variety of cancers, and thus represents an important biomarker for cancer progression and a potential target for anticancer drugs (PMID: 21730960). In nonmalignant tissues, PGRMC1 is highly expressed in the liver and kidney (PMID: 9705155; 20164297).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 PGRMC1 antibody CL488-66372 | Download protocol | 
| IF protocol for CL Plus 488 PGRMC1 antibody CL488-66372 | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 



