CoraLite®594-conjugated PGRMC1 Monoclonal antibody

• 

  IF Staining of human ovary tumor using CL594-66372

  Immunofluorescent analysis of (4% PFA) fixed human ovary tumor tissue using CoraLite®594 PGRMC1 antibody (CL594-66372, Clone: 1C10D11 ) at dilution of 1:200.

• 

  IF Staining of human ovary tumor using CL594-66372

  Immunofluorescent analysis of (4% PFA) fixed human ovary tumor tissue using CoraLite®594 PGRMC1 antibody (CL594-66372, Clone: 1C10D11 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

PGRMC1 Monoclonal Antibody for IF-P

Cat No. CL594-66372

Clone No.1C10D11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

IF-P

Synonyms

HPR6.6, MPR, PGRMC, PGRMC1

---

Tested Applications

• Positive IF-P detected in: human ovary tumor tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66372 targets PGRMC1 in IF-P applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3643

  Product name: Recombinant human PGRMC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 43-195 aa of BC034238

  Sequence: YKIVRGDQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND

• Full Name: progesterone receptor membrane component 1
• Calculated Molecular Weight: 195 aa, 22 kDa
• Observed Molecular Weight: 25-27 kDa
• GenBank Accession Number: BC034238
• Gene Symbol: PGRMC1
• Gene ID (NCBI): 10857
• RRID: AB_2919983
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00264
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Progesterone receptor membrane component 1 (PGRMC1) is a member of a multi-protein progesterone-binding complex. However, PGRMC1 shares homology with cytochrome b5-related proteins rather than hormone receptors (PMID: 18992768). It is a heme binding protein with biding sites for Src homology (SH2) and SH3 domain-containing proteins (PMID: 17583495). PGRMC1 is overexpressed in a variety of cancers, and thus represents an important biomarker for cancer progression and a potential target for anticancer drugs (PMID: 21730960). In nonmalignant tissues, PGRMC1 is highly expressed in the liver and kidney (PMID: 9705155; 20164297).