PGRMC2 Recombinant monoclonal antibody

• 

  WB analysis using 86835-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86835-1-RR (PGRMC2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 86835-1-RR

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 86835-1-RR (PGRMC2 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 86835-1-RR

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 86835-1-RR (PGRMC2 antibody) at dilution of 1:5000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 86835-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PGRMC2 antibody (86835-1-RR, Clone: 251819A8 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

PGRMC2 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 86835-1-RR

Clone No.251819A8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

DG6, Membrane-associated progesterone receptor component 2, PMBP

---

Tested Applications

• Positive WB detected in: HeLa cells, ARPE-19 cells, HepG2 cells, MDA-MB-231 cells, NIH/3T3 cells, 3T3-L1 cells
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:2500-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86835-1-RR targets PGRMC2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag20077

  Product name: Recombinant human PGRMC2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 55-145 aa of BC016692

  Sequence: LLNVALVALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGI

• Full Name: progesterone receptor membrane component 2
• Calculated Molecular Weight: 223 aa, 24 kDa
• Observed Molecular Weight: 24 kDa, 28 kDa
• GenBank Accession Number: BC016692
• Gene Symbol: PGRMC2
• Gene ID (NCBI): 10424
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15173
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Membrane-associated progesterone receptor component 2 (PGRMC2), also known as DG6 or PMBP, belongs to the cytochrome b5 family. This protein might play a role in cancer. The gene of PGRMC2 maps to chromosome 4q26, and encodes a 223-amino acid single-pass membrane protein with a cytochrome b5 heme-binding domain in its cytoplasmic domain. PGRMC2 has a calculated molecular weight of 24 kDa. The band of about 28 kDa detected by this antibody is unknown but may represent phosphorylated form of PGRMC2 (PMID: 28104494).