• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated PGRMC2 Monoclonal antibody

PGRMC2 Monoclonal Antibody for IF-P, FC (Intra)
Cat No. CL488-60249
Clone No.5F10D7

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

IF-P, FC (Intra)

5F10D7, DG6, Membrane-associated progesterone receptor component 2, PMBP

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman placenta tissue
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60249 targets PGRMC2 in IF-P, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20077

Product name: Recombinant human PGRMC2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 55-145 aa of BC016692

Sequence: LLNVALVALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGI

Predict reactive species
Full Name progesterone receptor membrane component 2
Calculated Molecular Weight 223 aa, 24 kDa
Observed Molecular Weight 24+28 kDa
GenBank Accession NumberBC016692
Gene Symbol PGRMC2
Gene ID (NCBI) 10424
RRIDAB_3084144
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15173
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Membrane-associated progesterone receptor component 2 (PGRMC2), also known as DG6 or PMBP, belongs to the cytochrome b5 family. This protein might play a role in cancer. The gene of PGRMC2 maps to chromosome 4q26, and encodes a 223-amino acid single-pass membrane protein with a cytochrome b5 heme-binding domain in its cytoplasmic domain. PGRMC2 has a calculated molecular weight of 24 kDa. The band of about 28 kDa detected by this monoclonal antibody is unknown but may represent phosphorylated form of PGRMC2 (PMID: 28104494).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 PGRMC2 antibody CL488-60249Download protocol
IF protocol for CL Plus 488 PGRMC2 antibody CL488-60249Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...