Tested Applications
| Positive IF-P detected in | human placenta tissue |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-60249 targets PGRMC2 in IF-P, FC (Intra) applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20077 Product name: Recombinant human PGRMC2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 55-145 aa of BC016692 Sequence: LLNVALVALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGI Predict reactive species |
| Full Name | progesterone receptor membrane component 2 |
| Calculated Molecular Weight | 223 aa, 24 kDa |
| Observed Molecular Weight | 24+28 kDa |
| GenBank Accession Number | BC016692 |
| Gene Symbol | PGRMC2 |
| Gene ID (NCBI) | 10424 |
| RRID | AB_3084144 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O15173 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Membrane-associated progesterone receptor component 2 (PGRMC2), also known as DG6 or PMBP, belongs to the cytochrome b5 family. This protein might play a role in cancer. The gene of PGRMC2 maps to chromosome 4q26, and encodes a 223-amino acid single-pass membrane protein with a cytochrome b5 heme-binding domain in its cytoplasmic domain. PGRMC2 has a calculated molecular weight of 24 kDa. The band of about 28 kDa detected by this monoclonal antibody is unknown but may represent phosphorylated form of PGRMC2 (PMID: 28104494).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 PGRMC2 antibody CL488-60249 | Download protocol |
| IF protocol for CL Plus 488 PGRMC2 antibody CL488-60249 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



