PGT Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse heart using 83302-1-RR (same clone as 83302-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 83302-1-RR (PGT antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83302-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 83302-1-RR (same clone as 83302-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 83302-1-RR (PGT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83302-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83302-1-RR (same clone as 83302-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug PGT Recombinant antibody (83302-1-RR, Clone:230139F5) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83302-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83302-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83302-1-RR against Human PGT were performed. The affinity constant is below 1 pM.

PGT Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 83302-1-PBS

Clone No.230139F5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

SLCO2A1, 230139F5, OATP2A1, PHOAR2

---

Product Information

83302-1-PBS targets PGT in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5594

  Product name: Recombinant human PGT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 422-643 aa of BC041140

  Sequence: TPTVAEVYPPSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAHFLLPAIFLISFVSLIACISHNPLYMMVLRVVNQEEKSFAIGVQFLLMRLLAWLPSPALYGLTIDHSCIRWNSLCLGRRGACAYYDNDALRDRYLGLQMGYKALGMLLLCFISWRVKKNKEYNVQKAAGLI

• Full Name: solute carrier organic anion transporter family, member 2A1
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC041140
• Gene Symbol: PGT
• Gene ID (NCBI): 6578
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q92959
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Prostaglandin transporter (PGT), also known as SLCO2A1, has been identified as a functional prostaglandin (PG) carrier that mediates either the release of newly-synthesized PGs by cells and/or the uptake of PGs prior to intracellular oxidation. Northern blot analysis revealed that PGT mRNA has broad tissue distribution, suggesting its role in the transport and/ or metabolic clearance of PG in diverse tissues (PMID: 8787677,22331663).