PGT Recombinant monoclonal antibody

PGT Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83302-1-RR
Clone No.230139F5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), ELISA

SLCO2A1, 230139F5, OATP2A1, PHOAR2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNIH/3T3 cells, mouse heart tissue
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83302-1-RR targets PGT in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5594

Product name: Recombinant human PGT protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 422-643 aa of BC041140

Sequence: TPTVAEVYPPSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAHFLLPAIFLISFVSLIACISHNPLYMMVLRVVNQEEKSFAIGVQFLLMRLLAWLPSPALYGLTIDHSCIRWNSLCLGRRGACAYYDNDALRDRYLGLQMGYKALGMLLLCFISWRVKKNKEYNVQKAAGLI

Predict reactive species
Full Name solute carrier organic anion transporter family, member 2A1
Calculated Molecular Weight 70 kDa
Observed Molecular Weight 65 kDa
GenBank Accession NumberBC041140
Gene Symbol PGT
Gene ID (NCBI) 6578
RRIDAB_3670971
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ92959
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Prostaglandin transporter (PGT), also known as SLCO2A1, has been identified as a functional prostaglandin (PG) carrier that mediates either the release of newly-synthesized PGs by cells and/or the uptake of PGs prior to intracellular oxidation. Northern blot analysis revealed that PGT mRNA has broad tissue distribution, suggesting its role in the transport and/ or metabolic clearance of PG in diverse tissues (PMID: 8787677,22331663).

Protocols

Product Specific Protocols
FC protocol for PGT antibody 83302-1-RRDownload protocol
WB protocol for PGT antibody 83302-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...