PHF10 Monoclonal antibody, PBS Only

PHF10 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 66341-1-PBS
Clone No.4D4C6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

BAF45a, BRG1 associated factor 45a, PHD finger protein 10, PHF10, XAP135

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66341-1-PBS targets PHF10 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19096

Product name: Recombinant human PHF10 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-408 aa of BC020954

Sequence: MLQEQVSEYLGVTSFKRKYPERRDLSHKEKLYLRELNVITETQCTLGLTALRSDEVIDLMIKEYPAKHAEYSVILQEKERQRITDHYKEYSQMQQQNTQKVEASKVPEYIKKAAKKAAEFNSNLNRERMEERRAYFDLQTHVIQVPQGKYKVLPTERTKVSSYPVALIPGQFQEYYKRYSPDELRYLPLNTALYEPPLDPELPALDSDGDSDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKPKVIPNAICGICLKGKESNKKGKAESLIHCSQCENSGHPSCLDMTMELVSMIKTYPWQCMECKTCIICGQPHHEEEMMFCDMCDRGYHTFCVGLGAIPSGRWICDCCQRAPPTPRKVGRRGKNSKEG

Predict reactive species
Full Name PHD finger protein 10
Calculated Molecular Weight 408 aa, 46 kDa
Observed Molecular Weight 56 kDa, 35 kDa
GenBank Accession NumberBC020954
Gene Symbol PHF10
Gene ID (NCBI) 55274
RRIDAB_2881721
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8WUB8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PHF10, also named as BRG1-associated factor 45a, is a 498 amino acid protein, which locate in the nucleus and Belongs to the SAYP family. PHF10 Involve in transcription activity regulation by chromatin remodeling. It Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and is required for the proliferation of neural progenitors. During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. PHF10 exists as several isoform and the calculated molecular weight of each isoform is 42 kDa, 37 kDa, 51 kDa, and 56 kDa.

Loading...
||
New chat Able
正在加载,请稍候...