PHF19 Recombinant monoclonal antibody, PBS Only (Detector)

PHF19 Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83892-3-PBS
Clone No.241047D7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

241047D7, hPCL3, MTF2L1, PCL3, PHD finger protein 19

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83892-3-PBS targets PHF19 as part of a matched antibody pair:

MP00868-2: 83892-5-PBS capture and 83892-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2511

Product name: Recombinant human PHF19 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-207 aa of BC022374

Sequence: MENRALDPGTRDSYGATSHLPNKGALAKVKNNFKDLMSKLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVPGEEPKCNICLGKTSGPLNEILICGKCGLGYHQQCHIPIAGSADQPLLTPWFCRRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALETDSASATVLGQDL

Predict reactive species
Full Name PHD finger protein 19
Calculated Molecular Weight 580 aa, 63 kDa
Observed Molecular Weight62-66 kDa
GenBank Accession NumberBC022374
Gene Symbol PHF19
Gene ID (NCBI) 26147
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ5T6S3-2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PHD FINGER PROTEIN 19(PHF19), a protein homologous to the Drosophila 'Polycomblike' (Pcl) protein, encoded by human gene PCL, which encodes 2 deduced proteins: a short form of 207 aa and a long form of 580 aa. The PCL family proteins contains a PCL homology domain, a Tudor domain, 2 PHD fingers and a C-terminal tail. It is highly expressed in thymus and heart, while 508aa form predominant in placenta, skeletal muscle and kidney and 207aa form in liver and peripheral blood leukocytes. Both of these forms can inhibit transcriptional activity. And the long form is corelated with cancer.Acts as a transcritpional repressor. The mRNA level of PHF19 is low in many normal tissue, it's elevated in cancer-derived cell lines.

Loading...
||
New chat Able
正在加载,请稍候...