PHF19 Recombinant monoclonal antibody

PHF19 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83892-3-RR
Clone No.241047D7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

Polycomb like protein 3, PHD finger protein 19, PCL3, MTF2L1, hPCL3

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells, HeLa cells, HEK-293T cells, NCCIT cells, U-251 cells
Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83892-3-RR targets PHF19 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2511

Product name: Recombinant human PHF19 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-207 aa of BC022374

Sequence: MENRALDPGTRDSYGATSHLPNKGALAKVKNNFKDLMSKLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVPGEEPKCNICLGKTSGPLNEILICGKCGLGYHQQCHIPIAGSADQPLLTPWFCRRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALETDSASATVLGQDL

Predict reactive species
Full Name PHD finger protein 19
Calculated Molecular Weight 580 aa, 63 kDa
Observed Molecular Weight62-66 kDa
GenBank Accession NumberBC022374
Gene Symbol PHF19
Gene ID (NCBI) 26147
RRIDAB_3671475
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ5T6S3-2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PHD FINGER PROTEIN 19(PHF19), a protein homologous to the Drosophila 'Polycomblike' (Pcl) protein, encoded by human gene PCL, which encodes 2 deduced proteins: a short form of 207 aa and a long form of 580 aa. The PCL family proteins contains a PCL homology domain, a Tudor domain, 2 PHD fingers and a C-terminal tail. It is highly expressed in thymus and heart, while 508aa form predominant in placenta, skeletal muscle and kidney and 207aa form in liver and peripheral blood leukocytes. Both of these forms can inhibit transcriptional activity. And the long form is corelated with cancer.Acts as a transcritpional repressor. The mRNA level of PHF19 is low in many normal tissue, it's elevated in cancer-derived cell lines.

Protocols

Product Specific Protocols
WB protocol for PHF19 antibody 83892-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...