PHF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PHF2 Polyclonal antibody, PBS Only (24624-1-PBS)

• 

  WB analysis of Jurkat using 24624-1-AP (same clone as 24624-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 24624-1-AP (PHF2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24624-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 24624-1-AP (same clone as 24624-1-PBS)

  IP result of anti-PHF2 (IP:24624-1-AP, 4ug; Detection:24624-1-AP 1:500) with HeLa cells lysate 1800ug. This data was developed using the same antibody clone with 24624-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 24624-1-AP (same clone as 24624-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 24624-1-AP (PHF2 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 24624-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 24624-1-AP (same clone as 24624-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 24624-1-AP (PHF2 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 24624-1-PBS in a different storage buffer formulation.

PHF2 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 24624-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

24624-1-PBS targets PHF2 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20257

  Product name: Recombinant human PHF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 445-780 aa of BC152437

  Sequence: ASKAVRPEVNTVASSDEVCDGDREKEEPPSPIEATPPQSLLEKVSKKKTPKTVKMPKPSKIPKPPKPPKPPRPPKTLKLKDGGKKKGKKSRESASPTIPNLDLLEAHTKEALTKMEPPKKGKATKSVLSVPNKDVVHMQNDVERLEIREQTKSKSEAKWKYKNSKPDSLLKMEEEQKLEKSPLAGNKDNKFSFSFSNKKLLGSKALRPPTSPGVFGALQNFKEDKPKPVRDEYEYVSDDGELKIDEFPIRRKKNAPKRDLSFLLDKKAVLPTPVTKPKLDSAAYKSDDSSDEGSLHIDTDTKPGRNARVKKESGSSAAGILDLLQASEEVGALEYN

• Full Name: PHD finger protein 2
• Calculated Molecular Weight: 1101 aa, 121 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC152437
• Gene Symbol: PHF2
• Gene ID (NCBI): 5253
• RRID: AB_2879644
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75151
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PHD finger protein 2 (PHF2), also known as JHDM1E (Jumonji C domain-containing histone demethylase 1E) or GRC5, is a 1101 amino acid protein, which contains one JmjC domain and one PHD-type zinc finger. PHF2 belongs to the JHDM1 histone demethylase family and localizes in the nucleus. PHF2 demethylases both histones and non-histione proteins. PHF2 is widely expressed in various tissues and exists as two alternative splicing isoforms. The gene encoding PHF2 lies in the candidate region for hereditary sensory neuropathy type I (HSN1), a disorder characterized by sensory dysfunction