PHF24 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PHF24 Polyclonal antibody, PBS Only (27959-1-PBS)

• 

  IHC staining of mouse brain using 27959-1-AP (same clone as 27959-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27959-1-AP (PHF24 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27959-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27959-1-AP (same clone as 27959-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27959-1-AP (PHF24 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27959-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 27959-1-AP (same clone as 27959-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using PHF24 antibody (27959-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27959-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 27959-1-AP (same clone as 27959-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using PHF24 antibody (27959-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27959-1-PBS in a different storage buffer formulation.

PHF24 Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 27959-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, Indirect ELISA

Synonyms

---

Product Information

27959-1-PBS targets PHF24 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27492

  Product name: Recombinant human PHF24 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-251 aa of NM_001304333

  Sequence: MSAFKDGLRDRPSIRRTGELPGSRRGTVEGSVQEVQEEKEAEAGTSVVQEESSAGRAAWERLRDGRGVEPEEFDRTSRFTPPAFIRPTRKLDDDKPPEICLEPREPVVNDEMCDVCEVWTAESLFPCRVCTRVFHDGCLRRMGYIQGDSAAEVTEMAHTETGWSCHYCDNINLLLTEEEMYSLTETFQRCKVIPDCSLTLEDFLRYRHQAAKRGDRDRALSEEQEEQAARQ

• Full Name: KIAA1045
• Calculated Molecular Weight: 45 aa
• GenBank Accession Number: NM_001304333
• Gene Symbol: PHF24
• Gene ID (NCBI): 23349
• RRID: AB_3086014
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UPV7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.