Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human liver tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22789-1-AP targets PHLPP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18794 Product name: Recombinant human PHLPP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1068-1204 aa of BC126277 Sequence: QQHLLQVPAEASDEGIVISANEDEPGLPRKADFSAVGTIGRRRANGSVAPQERSHNVIEVATDAPLRKPGGYFAAPAQPDPDDQFIIPPELEEEVKEIMKHHQEQQQQQQPPPPPQLQPQLPRHYQLDQLPDYYDTP Predict reactive species |
| Full Name | PH domain and leucine rich repeat protein phosphatase |
| Calculated Molecular Weight | 185 kDa, 134 kDa |
| Observed Molecular Weight | 185 kDa |
| GenBank Accession Number | BC126277 |
| Gene Symbol | PHLPP |
| Gene ID (NCBI) | 23239 |
| RRID | AB_2750897 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60346 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PHLPP (PH domain leucine-rich-repeats protein phosphatase) belongs to a novel family of Ser/Thr protein phosphatases that consists of PHLPP1 and PHLPP2 isoforms. It has been shown that PHLPP negatively regulates multiple oncogenic pathways by directly dephosphorylating and inactivating key signaling molecules, including Akt, S6K, and RAF1. This antibody detects both PHLPP1 alpha and PHLPP1 beta isoforms.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PHLPP1 antibody 22789-1-AP | Download protocol |
| IHC protocol for PHLPP1 antibody 22789-1-AP | Download protocol |
| IP protocol for PHLPP1 antibody 22789-1-AP | Download protocol |
| WB protocol for PHLPP1 antibody 22789-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PHLPP1 Polyclonal antibody (Cat# 22789-1-AP) has 42 citations across journals including Nature Cell Biology, Nature Communications, Molecular Cell, Cell Metabolism, Cell Reports, Molecular Cancer, Cell Death & Disease, EMBO Reports, PLoS Biology, Journal of Biological Chemistry, Oncotarget, and Biochemical Pharmacology. Research fields span oncology (colorectal, pancreatic, lung, gastric, cervical, and hepatocellular cancers), diabetes, cardiovascular disease, neurology, inflammation, metabolism, bone development, and PI3K/AKT/mTOR signaling pathways.
| Species | Application | Title |
|---|---|---|
Mol Cancer CircIL4R activates the PI3K/AKT signaling pathway via the miR-761/TRIM29/PHLPP1 axis and promotes proliferation and metastasis in colorectal cancer.
| ||
Cell Metab m6A mRNA methylation in brown fat regulates systemic insulin sensitivity via an inter-organ prostaglandin signaling axis independent of UCP1 | ||
Cell Mol Immunol CUL4B negatively regulates Toll-like receptor-triggered proinflammatory responses by repressing Pten transcription. | ||
Nat Cell Biol The metabolic enzyme hexokinase 2 localizes to the nucleus in AML and normal haematopoietic stem and progenitor cells to maintain stemness.
| ||
Nat Commun Discovery of a snail hibernation-inducer offering hibernation-like cardioprotection through metabolic rewiring and autophagy in mice. | ||
Mol Cell Protein Kinase C Quality Control by Phosphatase PHLPP1 Unveils Loss-of-Function Mechanism in Cancer.
|
Reviews
What customers say
The single review for this product is a 5-star rating from a Western Blot application using SHED cell lines. The reviewer reported that the antibody performed very well, expressing clear satisfaction with its performance. Overall, the feedback is positive, indicating reliable results in the tested application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Slavica (Verified Customer) (10-04-2021) | The antibody worked very well!
|
