PHOSPHO2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PHOSPHO2 Polyclonal antibody, PBS Only (11869-1-PBS)

• 

  WB analysis using 11869-1-AP (same clone as 11869-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11869-1-AP (PHOSPHO2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11869-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 11869-1-AP (same clone as 11869-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11869-1-AP (PHOSPHO2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11869-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 11869-1-AP (same clone as 11869-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11869-1-AP (PHOSPHO2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11869-1-PBS in a different storage buffer formulation.

PHOSPHO2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11869-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

EC:3.1.3.74

---

Product Information

11869-1-PBS targets PHOSPHO2 in WB, IHC, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2451

  Product name: Recombinant human PHOSPHO2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-241 aa of BC022324

  Sequence: MKILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGRVFKYLGDKGVREHEMKRAVTSLPFTPGMVELFNFIRKNKDKFDCIIISDSNSVFIDWVLEAASFHDIFDKVFTNPAAFNSNGHLTVENYHTHSCNRCPKNLCKKVVLIEFVDKQLQQGVNYTQIVYIGDGGNDVCPVTFLKNDDVAMPRKGYTLQKTLSRMSQNLEPMEYSVVVWSSGVDIISHLQFLIKD

• Full Name: phosphatase, orphan 2
• Calculated Molecular Weight: 241 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC022324
• Gene Symbol: PHOSPHO2
• Gene ID (NCBI): 493911
• RRID: AB_3085383
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TCD6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PHOSPHO2 belongs to the HAD-like hydrolase superfamily and PHOSPHO family. PHOSPHO2 is a phosphatase that has high activity toward pyridoxal 5'-phosphate (PLP). PHOSPHO2 is also active at much lower level toward pyrophosphate, phosphoethanolamine (PEA), phosphocholine (PCho), phospho-l-tyrosine, fructose-6-phosphate, p-nitrophenyl phosphate, and h-glycerophosphate. The molecular weight of PHOSPHO2 is 28 kDa.