PI4KB Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PI4KB Recombinant monoclonal antibody (86285-3-RR)

• 

  WB analysis using 86285-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86285-3-RR (PI4KB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

PI4KB Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86285-3-RR

Clone No.250858C4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

EC:2.7.1.67, Phosphatidylinositol 4-kinase beta, PI4K-beta, PI4KIII, PIK4CB

---

Tested Applications

• Positive WB detected in: K-562 cells, Jurkat cells, HeLa cells, SH-SY5Y cells, BxPC-3 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86285-3-RR targets PI4KB in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3989

  Product name: Recombinant human PI4KB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 449-801 aa of BC040300

  Sequence: IGELQVELPEVHTNSCDNISQFSVDSITSQESKEPVFIAAGDIRRRLSEQLAHTPTAFKRDPEDPSAVALKEPWQEKVRRIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGYCLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSPRNLGFETSAFKLTTEFVDVMGGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM

• Full Name: phosphatidylinositol 4-kinase, catalytic, beta
• Calculated Molecular Weight: 801 aa, 90 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC040300
• Gene Symbol: PI4KB
• Gene ID (NCBI): 5298
• RRID: AB_3744782
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UBF8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PI4KB(phosphatidylinositol 4-kinase beta) is also named as PIK4CB, NPIK, PI4K92 and belongs to the PI3/PI4-kinase family. It may regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation and involved in Golgi-to-plasma membrane trafficking. PI4KB is a type III enzyme that is sensitive to wortmannin(PMID:9020160). This protein has 3 isoforms produced by alternative splicing.